PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 193aa    MW: 22693.2 Da    PI: 9.5928
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20262.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM141.26.3e-44201511128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk..leleevikev.diykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                lppGfrF+Ptdeelv +yL+ kv + +     +++++e+ ++ +++PwdLp++    e++ yfFs+++ ky++gkr+nr t+ gyWk+tg+dk+++s+  
  PK20262.1  20 LPPGFRFQPTDEELVFQYLRCKVFSFPlpPYSSDIVPEIiNLSTYDPWDLPSASGDLEQDRYFFSNKEGKYKNGKRSNRRTSCGYWKSTGSDKKIVSStM 119
                79***********************996533346788888***********6666667789***********************************9866 PP

        NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                ++ vg++ktLvfy+g+ p+g +t+W+mhey+l
  PK20262.1 120 KNIVGTRKTLVFYNGKPPHGARTHWFMHEYTL 151
                777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5016178IPR003441NAC domain
PROSITE profilePS5100552.22120178IPR003441NAC domain
PfamPF023653.3E-2521151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MNNNNNKYNF VRNNNGVIKL PPGFRFQPTD EELVFQYLRC KVFSFPLPPY SSDIVPEIIN  60
LSTYDPWDLP SASGDLEQDR YFFSNKEGKY KNGKRSNRRT SCGYWKSTGS DKKIVSSTMK  120
NIVGTRKTLV FYNGKPPHGA RTHWFMHEYT LTFDPQQISQ NQISTDQNNW VLCRIFYKER  180
TSKKDVEDDH HHX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-421818418174NAC domain-containing protein 19
3swp_C2e-421818418174NAC domain-containing protein 19
3swp_B2e-421818418174NAC domain-containing protein 19
3swp_A2e-421818418174NAC domain-containing protein 19
3swm_D2e-421818418174NAC domain-containing protein 19
3swm_C2e-421818418174NAC domain-containing protein 19
3swm_B2e-421818418174NAC domain-containing protein 19
3swm_A2e-421818418174NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093938.12e-80NAC domain-containing protein 29
SwissprotQ9FY939e-62NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A060A6578e-85A0A060A657_BOENI; NAC domain-containing protein
STRINGVIT_17s0000g00770.t014e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.15e-62NAC domain containing protein 83